![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries) Uniprot Q93068 |
![]() | Domain d1a5ra_: 1a5r A: [37597] |
PDB Entry: 1a5r (more details)
SCOPe Domain Sequences for d1a5ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5ra_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv
Timeline for d1a5ra_: