Class b: All beta proteins [48724] (180 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein beta-Crystallin [49702] (4 species) duplication consists of two domains of this fold |
Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries) |
Domain d1a5da2: 1a5d A:85-174 [23615] |
PDB Entry: 1a5d (more details), 2.3 Å
SCOPe Domain Sequences for d1a5da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5da2 b.11.1.1 (A:85-174) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]} sshririyeredyrgqmveitddcphlqdrfhfsdfhsfhvmegywvlyempnyrgrqyl lrpgeyrryhdwgamnarvgslrrimdfy
Timeline for d1a5da2: