Lineage for d1a5da1 (1a5d A:1-84)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 661690Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 661691Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) (S)
  5. 661692Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 661693Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 661715Species Rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)
  8. 661724Domain d1a5da1: 1a5d A:1-84 [23614]

Details for d1a5da1

PDB Entry: 1a5d (more details), 2.3 Å

PDB Description: gammae crystallin from rat lens
PDB Compounds: (A:) gammae crystallin

SCOP Domain Sequences for d1a5da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5da1 b.11.1.1 (A:1-84) beta-Crystallin {Rat (Rattus norvegicus), isoform E [TaxId: 10116]}
gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
dypdyqqwmgfsdsvrscrliphs

SCOP Domain Coordinates for d1a5da1:

Click to download the PDB-style file with coordinates for d1a5da1.
(The format of our PDB-style files is described here.)

Timeline for d1a5da1:

661724
d1a5da1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1a5da2