Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein) |
Protein HSP90 [55876] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55877] (7 PDB entries) |
Domain d1a4h__: 1a4h - [41099] complexed with gmy |
PDB Entry: 1a4h (more details), 2.5 Å
SCOP Domain Sequences for d1a4h__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4h__ d.122.1.1 (-) HSP90 {Baker's yeast (Saccharomyces cerevisiae)} masetfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletep dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd qleyleekrikevikrhsefvaypiqlvvtkeve
Timeline for d1a4h__: