Lineage for d1a4ea_ (1a4e A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620686Protein Catalase I [56636] (8 species)
  7. 2620687Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56639] (1 PDB entry)
  8. 2620688Domain d1a4ea_: 1a4e A: [42806]
    complexed with azi, hem, so4

Details for d1a4ea_

PDB Entry: 1a4e (more details), 2.4 Å

PDB Description: catalase a from saccharomyces cerevisiae
PDB Compounds: (A:) catalase a

SCOPe Domain Sequences for d1a4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvredrvvtnstgnpinepfvtqrigehgplllqdynlidslahfnrenipqrnphahgs
gafgyfevtdditdicgsamfskigkrtkcltrfstvggdkgsadtvrdprgfatkfyte
egnldwvynntpvffirdpskfphfihtqkrnpqtnlrdadmfwdflttpenqvaihqvm
ilfsdrgtpanyrsmhgysghtykwsnkngdwhyvqvhiktdqgiknltieeatkiagsn
pdycqqdlfeaiqngnypswtvyiqtmterdakklpfsvfdltkvwpqgqfplrrvgkiv
lnenplnffaqveqaafapsttvpyqeasadpvlqarlfsyadahryrlgpnfhqipvnc
pyaskffnpairdgpmnvngnfgseptylandksytyiqqdrpiqqhqevwngpaipyhw
atspgdvdfvqarnlyrvlgkqpgqqknlaynigihvegacpqiqqrvydmfarvdkgls
eaikkvae

SCOPe Domain Coordinates for d1a4ea_:

Click to download the PDB-style file with coordinates for d1a4ea_.
(The format of our PDB-style files is described here.)

Timeline for d1a4ea_: