Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
Protein p52 subunit of NF-kappa B (NFKB), N-terminal domain [49426] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49427] (1 PDB entry) |
Domain d1a3qa2: 1a3q A:37-226 [22447] Other proteins in same PDB: d1a3qa1, d1a3qb1 protein/DNA complex |
PDB Entry: 1a3q (more details), 2.1 Å
SCOPe Domain Sequences for d1a3qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3qa2 b.2.5.3 (A:37-226) p52 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrslplkpvisqpihdsks pgas
Timeline for d1a3qa2: