Lineage for d1a23__ (1a23 -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 585398Family c.47.1.13: DsbA-like [100953] (2 proteins)
    contains an all-alpha subdomain insertion
  6. 585399Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species)
    the insert subdomain is a 4-helical bundle
  7. 585400Species Escherichia coli [TaxId:562] [100955] (12 PDB entries)
  8. 585423Domain d1a23__: 1a23 - [90319]

Details for d1a23__

PDB Entry: 1a23 (more details)

PDB Description: solution nmr structure of reduced dsba from escherichia coli, minimized average structure

SCOP Domain Sequences for d1a23__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a23__ c.47.1.13 (-) Disulfide-bond formation facilitator (DsbA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsekk

SCOP Domain Coordinates for d1a23__:

Click to download the PDB-style file with coordinates for d1a23__.
(The format of our PDB-style files is described here.)

Timeline for d1a23__: