Class b: All beta proteins [48724] (149 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) |
Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 |
Protein RNA polymerase subunit RBP8 [50322] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (10 PDB entries) |
Domain d1a1d__: 1a1d - [25394] CA-atoms only |
PDB Entry: 1a1d (more details)
SCOP Domain Sequences for d1a1d__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1d__ b.40.4.8 (-) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)} msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg llmrlegnyrnlnnlkqenayllirr
Timeline for d1a1d__: