Lineage for d1a0ql1 (1a0q L:2-108)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (213 PDB entries)
Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
Domain d1a0ql1: 1a0q L:2-108 [20286]
Other proteins in same PDB: d1a0qh1, d1a0qh2, d1a0ql2
part of catalytic antibody 29G11 with esterase activity
complexed with hep, zn
Details for d1a0ql1
PDB Entry: 1a0q (more details), 2.3 Å
PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
PDB Compounds: (L:) 29g11 fab (light chain)SCOPe Domain Sequences for d1a0ql1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
ieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgipsr
frgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikr
SCOPe Domain Coordinates for d1a0ql1:
Click to download the PDB-style file with coordinates for d1a0ql1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a0ql1:
- d1a0ql1 first appeared (with stable ids) in SCOP 1.55
- d1a0ql1 appears in SCOPe 2.04
- d1a0ql1 appears in SCOPe 2.06
- d1a0ql1 appears in the current release, SCOPe 2.08
View in 3D
