Lineage for d1a0ia1 (1a0i A:241-349)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) 
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) Protein ATP-dependent DNA ligase [50310] (2 species) 
Species Bacteriophage T7 [TaxId:10760] [50311] (1 PDB entry) 
Domain d1a0ia1: 1a0i A:241-349 [25363]
Other proteins in same PDB: d1a0ia2
complexed with atp; mutant
Details for d1a0ia1
PDB Entry: 1a0i (more details), 2.6 Å
PDB Description: atp-dependent dna ligase from bacteriophage t7 complex with atp
PDB Compounds: (A:) DNA ligaseSCOP Domain Sequences for d1a0ia1:
Sequence, based on SEQRES records: (download)
>d1a0ia1 b.40.4.6 (A:241-349) ATP-dependent DNA ligase {Bacteriophage T7 [TaxId: 10760]}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr
Sequence, based on observed residues (ATOM records): (download)
>d1a0ia1 b.40.4.6 (A:241-349) ATP-dependent DNA ligase {Bacteriophage T7 [TaxId: 10760]}
peneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatl
sqwgffdactinpydgwacqisymeetpdgslrhpsfvmfr
SCOP Domain Coordinates for d1a0ia1:
Click to download the PDB-style file with coordinates for d1a0ia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a0ia1:
- d1a0ia1 first appeared (with stable ids) in SCOP 1.55, called d1a0i_1
- d1a0ia1 appears in SCOP 1.73
- d1a0ia1 appears in SCOPe 2.01
- d1a0ia1 appears in the current release, SCOPe 2.08
View in 3D
