Lineage for d1914a2 (1914 A:2001-2097)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
(beta)-alpha-beta(3)-alpha; 2 layers, alpha/betaSuperfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) 
Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins) 
Protein Signal recognition particle 14KDa protein, SRP14 [88848] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [88850] (1 PDB entry) 
Domain d1914a2: 1914 A:2001-2097 [83029]
Other proteins in same PDB: d1914a1
single polypeptide chain construct with SRP9 and linker, res. 3001-3008
complexed with bme, po4
Details for d1914a2
PDB Entry: 1914 (more details), 2.53 Å
PDB Description: signal recognition particle alu rna binding heterodimer, srp9/14
PDB Compounds: (A:) signal recognition particle 9/14 fusion proteinSCOP Domain Sequences for d1914a2:
Sequence, based on SEQRES records: (download)
>d1914a2 d.49.1.1 (A:2001-2097) Signal recognition particle 14KDa protein, SRP14 {Mouse (Mus musculus) [TaxId: 10090]}
mvlleseqflteltrlfqkcrssgsvfitlkkydgrtkpiprkssveglepaenkcllra
tdgkrkistvvsskevnkfqmaysnllranmdglkkr
Sequence, based on observed residues (ATOM records): (download)
>d1914a2 d.49.1.1 (A:2001-2097) Signal recognition particle 14KDa protein, SRP14 {Mouse (Mus musculus) [TaxId: 10090]}
mvlleseqflteltrlfqkcrssgsvfitlkkydeglepaenkcllratdgkrkistvvs
skevnkfqmaysnllranmdglkkr
SCOP Domain Coordinates for d1914a2:
Click to download the PDB-style file with coordinates for d1914a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1914a2:
- d1914a2 first appeared in SCOP 1.65, called d1914_2
- d1914a2 appears in SCOP 1.73
- d1914a2 appears in SCOPe 2.01
- d1914a2 appears in the current release, SCOPe 2.08
View in 3D
