Lineage for d1ursa_ (1urs A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) 
Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
contains a few additional helices in the C-terminal extension; homologous to thiaminase ISpecies Alicyclobacillus acidocaldarius [TaxId:405212] [102690] (3 PDB entries) 
Domain d1ursa_: 1urs A: [99833]
Details for d1ursa_
PDB Entry: 1urs (more details), 1.45 Å
PDB Description: x-ray structures of the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius
PDB Compounds: (A:) maltose-binding proteinSCOP Domain Sequences for d1ursa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]}
qtitvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvv
fgmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynk
klvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldt
pgavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgv
tpwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipall
svqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdf
vqniqkg
SCOP Domain Coordinates for d1ursa_:
Click to download the PDB-style file with coordinates for d1ursa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ursa_:
- d1ursa_ first appeared in SCOP 1.67
- d1ursa_ appears in SCOP 1.73
- d1ursa_ appears in SCOPe 2.01
- d1ursa_ appears in the current release, SCOPe 2.08
View in 3D
