Lineage for d1rkta1 (1rkt A:2-82)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761504Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 761525Protein Hypothetical transcriptional regulator YfiR [101005] (1 species)
  7. 761526Species Bacillus subtilis [TaxId:1423] [101006] (1 PDB entry)
  8. 761527Domain d1rkta1: 1rkt A:2-82 [97623]
    Other proteins in same PDB: d1rkta2, d1rktb2
    structural genomics

Details for d1rkta1

PDB Entry: 1rkt (more details), 1.95 Å

PDB Description: Crystal structure of yfiR, a putative transcriptional regulator from Bacillus subtilis
PDB Compounds: (A:) protein yfiR

SCOP Domain Sequences for d1rkta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]}
spkvtkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemfr
riietgldeglrkldksaehq

SCOP Domain Coordinates for d1rkta1:

Click to download the PDB-style file with coordinates for d1rkta1.
(The format of our PDB-style files is described here.)

Timeline for d1rkta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rkta2