Lineage for d1pjza_ (1pjz A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 840165Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein)
  6. 840166Protein Thiopurine S-methyltransferase [102567] (2 species)
  7. 840171Species Pseudomonas syringae [TaxId:317] [102568] (1 PDB entry)
  8. 840172Domain d1pjza_: 1pjz A: [94794]

Details for d1pjza_

PDB Entry: 1pjz (more details)

PDB Description: solution structure of thiopurine methyltransferase from pseudomonas syringae
PDB Compounds: (A:) thiopurine s-methyltransferase

SCOP Domain Sequences for d1pjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}
hqsevnkdlqqywsslnvvpgarvlvplcgksqdmswlsgqgyhvvgaelseaaveryft
ergeqphitsqgdfkvyaapgieiwcgdffaltardighcaafydraamialpadmrery
vqhlealmpqacsgllitleydqallegppfsvpqtwlhrvmsgnwevtkvggqdtlhss
arglkaglermdehvyvlerv

SCOP Domain Coordinates for d1pjza_:

Click to download the PDB-style file with coordinates for d1pjza_.
(The format of our PDB-style files is described here.)

Timeline for d1pjza_: