![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.5: alpha-Amylase inhibitor tendamistat [49497] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.5.1: alpha-Amylase inhibitor tendamistat [49498] (1 family) ![]() |
![]() | Family b.5.1.1: alpha-Amylase inhibitor tendamistat [49499] (1 protein) |
![]() | Protein alpha-Amylase inhibitor tendamistat [49500] (1 species) |
![]() | Species Streptomyces tendae [TaxId:1932] [49501] (6 PDB entries) |
![]() | Domain d1ok0a_: 1ok0 A: [93191] complexed with cl, gol |
PDB Entry: 1ok0 (more details), 0.93 Å
SCOP Domain Sequences for d1ok0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ok0a_ b.5.1.1 (A:) alpha-Amylase inhibitor tendamistat {Streptomyces tendae [TaxId: 1932]} dttvsepapscvtlyqswrysqadngcaetvtvkvvyeddteglcyavapgqittvgdgy igshgharylarcl
Timeline for d1ok0a_: