Lineage for d1p2fa2 (1p2f A:1-120)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (7 families) 
Family c.23.1.1: CheY-related [52173] (25 proteins) 
Protein Response regulator DrrB [89587] (1 species) Species Thermotoga maritima [TaxId:2336] [89588] (1 PDB entry) 
Domain d1p2fa2: 1p2f A:1-120 [87721]
Other proteins in same PDB: d1p2fa1
complexed with mse
Details for d1p2fa2
PDB Entry: 1p2f (more details), 1.8 Å
PDB Description: crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
PDB Compounds: (A:) Response regulatorSCOP Domain Sequences for d1p2fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}
mmwkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgye
icrmiketrpetwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrflerekk
SCOP Domain Coordinates for d1p2fa2:
Click to download the PDB-style file with coordinates for d1p2fa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p2fa2:
- d1p2fa2 first appeared in SCOP 1.65
- d1p2fa2 appears in SCOP 1.73
- d1p2fa2 appears in SCOPe 2.01
- d1p2fa2 appears in the current release, SCOPe 2.08
View in 3D
