Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (1 family) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (17 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Transcription factor inhibitor I-kappa-B-beta, IKBB [82634] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [82635] (2 PDB entries) |
Domain d1oy3d_: 1oy3 D: [87554] Other proteins in same PDB: d1oy3b_, d1oy3c_ |
PDB Entry: 1oy3 (more details), 2.05 Å
SCOP Domain Sequences for d1oy3d_:
Sequence, based on SEQRES records: (download)
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} vfgyvtedgdtalhlavihqhepfldfllgfsagheyldlqndlgqtalhlaailgeast veklyaagagvlvaergghtalhlacrvrahtcacvllqprpshprdasdtyltqsqdct pdtshapaavdsqpnpeneeeprdedwrlqleaenydghtplhvavihkdaemvrllrda gadlnkpeptcgrtplhlaveaqaasvlelllkagadptarmyggrtplgsallrpnpil arllrahgapepedg
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} vfgyvtedgdtalhlavihqhepfldfllgfsagheyldlqndlgqtalhlaailgeast veklyaagagvlvaergghtalhlacrvrahtcacvllqprpshprdadedwrlqleaen ydghtplhvavihkdaemvrllrdagadlnkpeptcgrtplhlaveaqaasvlelllkag adptarmyggrtplgsallrpnpilarllrahgapepedg
Timeline for d1oy3d_: