Lineage for d1mhna_ (1mhn A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796957Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families) (S)
  5. 796958Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 797016Protein Survival motor neuron protein 1, smn [63750] (1 species)
  7. 797017Species Human (Homo sapiens) [TaxId:9606] [63751] (2 PDB entries)
  8. 797018Domain d1mhna_: 1mhn A: [84964]

Details for d1mhna_

PDB Entry: 1mhn (more details), 1.8 Å

PDB Description: High resolution crystal structure of the SMN Tudor domain
PDB Compounds: (A:) Survival motor neuron protein

SCOP Domain Sequences for d1mhna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]}
lqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspice

SCOP Domain Coordinates for d1mhna_:

Click to download the PDB-style file with coordinates for d1mhna_.
(The format of our PDB-style files is described here.)

Timeline for d1mhna_: