Lineage for d1ki9a_ (1ki9 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829357Protein Adenylate kinase [52554] (14 species)
  7. 829358Species Archaeon Methanococcus thermolithotrophicus [TaxId:2186] [89661] (1 PDB entry)
  8. 829359Domain d1ki9a_: 1ki9 A: [84404]

Details for d1ki9a_

PDB Entry: 1ki9 (more details), 2.76 Å

PDB Description: Adenylate kinase from Methanococcus thermolithotrophicus
PDB Compounds: (A:) adenylate kinase

SCOP Domain Sequences for d1ki9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ki9a_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]}
knklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmrk
ldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiivv
etsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnlld
yaveelisvlr

SCOP Domain Coordinates for d1ki9a_:

Click to download the PDB-style file with coordinates for d1ki9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ki9a_: