Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) |
Family d.109.1.1: Gelsolin-like [55754] (4 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (28 PDB entries) Uniprot P20065 55-179 |
Domain d1nm1g_: 1nm1 G: [80653] Other proteins in same PDB: d1nm1a1, d1nm1a2 domain 1 complexed with atp, ca, mg, so2, so4 |
PDB Entry: 1nm1 (more details), 1.8 Å
SCOP Domain Sequences for d1nm1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nm1g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva sgf
Timeline for d1nm1g_: