Lineage for d1mkya2 (1mky A:173-358)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830327Protein Probable GTPase Der, N-terminal and middle domains [82406] (1 species)
    member of EngA subfamily of GTPases; contains two G domains
  7. 830328Species Thermotoga maritima [TaxId:2336] [82407] (1 PDB entry)
  8. 830330Domain d1mkya2: 1mky A:173-358 [79251]
    Other proteins in same PDB: d1mkya3
    complexed with gdp, mse, po4

Details for d1mkya2

PDB Entry: 1mky (more details), 1.9 Å

PDB Description: Structural Analysis of the Domain Interactions in Der, a Switch Protein Containing Two GTPase Domains
PDB Compounds: (A:) Probable GTP-binding protein engA

SCOP Domain Sequences for d1mkya2:

Sequence, based on SEQRES records: (download)

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}
skpeitdaikvaivgrpnvgkstlfnailnkeralvspipgttrdpvddevfidgrkyvf
vdtaglrrksrveprtvekysnyrvvdsiekadvvvivldatqgitrqdqrmaglmerrg
rasvvvfnkwdlvvhrekrydeftklfreklyfidyspliftsadkgwnidrmidamnla
yasytt

Sequence, based on observed residues (ATOM records): (download)

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}
skpeitdaikvaivgrpnvgkstlfnailnkeralvspipvddevfidgrkyvfvdtagl
ekysnyrvvdsiekadvvvivldatqgitrqdqrmaglmerrgrasvvvfnkwdlvvhre
krydeftklfreklyfidyspliftsadkgwnidrmidamnlayasytt

SCOP Domain Coordinates for d1mkya2:

Click to download the PDB-style file with coordinates for d1mkya2.
(The format of our PDB-style files is described here.)

Timeline for d1mkya2: