Lineage for d1mixa1 (1mix A:195-308)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
core: 3 helices; bundle, closed, left-handed twist; up-and-downSuperfamily a.11.2: Second domain of FERM [47031] (1 family) 
Family a.11.2.1: Second domain of FERM [47032] (8 proteins) 
Protein Talin [81716] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [81717] (5 PDB entries) 
Domain d1mixa1: 1mix A:195-308 [79166]
Other proteins in same PDB: d1mixa2
Details for d1mixa1
PDB Entry: 1mix (more details), 1.75 Å
PDB Description: Crystal structure of a FERM domain of Talin
PDB Compounds: (A:) TalinSCOP Domain Sequences for d1mixa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
mkffysdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqk
hkpgflelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslkty
SCOP Domain Coordinates for d1mixa1:
Click to download the PDB-style file with coordinates for d1mixa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mixa1:
- d1mixa1 first appeared in SCOP 1.63
- d1mixa1 appears in SCOP 1.73
- d1mixa1 appears in SCOPe 2.01
- d1mixa1 appears in the current release, SCOPe 2.08
View in 3D
