Lineage for d1mi0a_ (1mi0 A:)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) 
Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species) Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries) 
Domain d1mi0a_: 1mi0 A: [79135]
redesigned protein variant nuG2
Details for d1mi0a_
PDB Entry: 1mi0 (more details), 1.85 Å
PDB Description: crystal structure of the redesigned protein g variant nug2
PDB Compounds: (A:) immunoglobulin-binding protein GSCOP Domain Sequences for d1mi0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mi0a_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
hhhamdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatktftvt
e
SCOP Domain Coordinates for d1mi0a_:
Click to download the PDB-style file with coordinates for d1mi0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mi0a_:
- d1mi0a_ first appeared in SCOP 1.63
- d1mi0a_ appears in SCOP 1.73
- d1mi0a_ appears in SCOPe 2.01
- d1mi0a_ appears in the current release, SCOPe 2.08, called d1mi0a1
View in 3D
