Lineage for d1mc0a2 (1mc0 A:402-555)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.2: GAF domain-like [55781] (4 families) 
alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654Family d.110.2.1: GAF domain [55782] (7 proteins) 
Protein 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains [82760] (1 species)
GAF B is the nucleotide binding domain; the two domains are connected with a long helix;Species Mouse (Mus musculus) [TaxId:10090] [82761] (1 PDB entry) 
Domain d1mc0a2: 1mc0 A:402-555 [78938]
complexed with pcg; mutant
Details for d1mc0a2
PDB Entry: 1mc0 (more details), 2.86 Å
PDB Description: Regulatory Segment of Mouse 3',5'-Cyclic Nucleotide Phosphodiesterase 2A, Containing the GAF A and GAF B Domains
PDB Compounds: (A:) 3',5'-cyclic nucleotide phosphodiesterase 2ASCOP Domain Sequences for d1mc0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mc0a2 d.110.2.1 (A:402-555) 3',5'-cyclic nucleotide phosphodiesterase 2A, GAF A and GAF B domains {Mouse (Mus musculus) [TaxId: 10090]}
dvsvllqeiitearnlsnaeicsvflldqnelvakvfdggvvddesyeiripadqgiagh
vattgqilnipdayahplfyrgvddstgfrtrnilcfpiknenqevigvaelvnkingpw
fskfdedlatafsiycgisiahsllykkvneaqy
SCOP Domain Coordinates for d1mc0a2:
Click to download the PDB-style file with coordinates for d1mc0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mc0a2:
- d1mc0a2 first appeared in SCOP 1.63
- d1mc0a2 appears in SCOP 1.73
- d1mc0a2 appears in SCOPe 2.01
- d1mc0a2 appears in the current release, SCOPe 2.08
View in 3D
