Lineage for d1k4ma_ (1k4m A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827434Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 827617Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)
  6. 827646Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (5 species)
  7. 827674Species Escherichia coli [TaxId:562] [82358] (2 PDB entries)
  8. 827675Domain d1k4ma_: 1k4m A: [77258]

Details for d1k4ma_

PDB Entry: 1k4m (more details), 1.9 Å

PDB Description: Crystal structure of E.coli nicotinic acid mononucleotide adenylyltransferase complexed to deamido-NAD
PDB Compounds: (A:) NaMN adenylyltransferase

SCOP Domain Sequences for d1k4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]}
mkslqalfggtfdpvhyghlkpvetlanligltrvtiipnnvpphrpqpeansvqrkhml
elaiadkplftlderelkrnapsytaqtlkewrqeqgpdvplafiigqdslltfptwyey
etildnahlivcrrpgyplemaqpqyqqwledhlthnpedlhlqpagkiylaetpwfnis
atiirerlqngescedllpepvltyinqqglyr

SCOP Domain Coordinates for d1k4ma_:

Click to download the PDB-style file with coordinates for d1k4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1k4ma_: