Lineage for d1l1za1 (1l1z A:135-222)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779340Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 779341Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 779342Species Bacillus stearothermophilus [TaxId:1422] [81611] (9 PDB entries)
  8. 779345Domain d1l1za1: 1l1z A:135-222 [75911]
    Other proteins in same PDB: d1l1za2, d1l1za3
    covalent-DNA intermediate
    complexed with ped, zn

Details for d1l1za1

PDB Entry: 1l1z (more details), 1.7 Å

PDB Description: MutM (Fpg) Covalent-DNA Intermediate
PDB Compounds: (A:) MutM

SCOP Domain Sequences for d1l1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1za1 a.156.1.2 (A:135-222) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstv

SCOP Domain Coordinates for d1l1za1:

Click to download the PDB-style file with coordinates for d1l1za1.
(The format of our PDB-style files is described here.)

Timeline for d1l1za1: