Lineage for d1lf7a_ (1lf7 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805942Protein Complement protein C8gamma [74998] (1 species)
  7. 805943Species Human (Homo sapiens) [TaxId:9606] [74999] (2 PDB entries)
  8. 805944Domain d1lf7a_: 1lf7 A: [73878]
    complexed with cit; mutant

Details for d1lf7a_

PDB Entry: 1lf7 (more details), 1.2 Å

PDB Description: crystal structure of human complement protein c8gamma at 1.2 a resolution
PDB Compounds: (A:) Complement Protein C8gamma

SCOP Domain Sequences for d1lf7a_:

Sequence, based on SEQRES records: (download)

>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]}
aspistiqpkanfdaqqfagtwllvavgsagrflqeqghraeattlhvapqgtamavstf
rkldgicwqvrqlygdtgvlgrfllqargargavhvvvaetdyqsfavlyleragqlsvk
lyarslpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

Sequence, based on observed residues (ATOM records): (download)

>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]}
aspistiqpkanfdaqqfagtwllvavgsagrraeattlhvapqgtamavstfrkldgic
wqvrqlygdtgvlgrfllqargargavhvvvaetdyqsfavlyleragqlsvklyarslp
vsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

SCOP Domain Coordinates for d1lf7a_:

Click to download the PDB-style file with coordinates for d1lf7a_.
(The format of our PDB-style files is described here.)

Timeline for d1lf7a_: