Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins) |
Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species) duplication: contains tandem repeat of two HMA domains in the N-terminal region |
Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries) |
Domain d1jwwa_: 1jww A: [71919] domain 2 |
PDB Entry: 1jww (more details)
SCOP Domain Sequences for d1jwwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwwa_ d.58.17.1 (A:) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} vtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea vdklgyklklkgeqdsiegr
Timeline for d1jwwa_: