Lineage for d1kjwa1 (1kjw A:430-525)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796424Protein Psd-95 [69248] (1 species)
    associates with a guanylate kinase domain
  7. 796425Species Rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries)
  8. 796426Domain d1kjwa1: 1kjw A:430-525 [68643]
    Other proteins in same PDB: d1kjwa2
    complexed with so4

Details for d1kjwa1

PDB Entry: 1kjw (more details), 1.8 Å

PDB Description: sh3-guanylate kinase module from psd-95
PDB Compounds: (A:) postsynaptic density protein 95

SCOP Domain Sequences for d1kjwa1:

Sequence, based on SEQRES records: (download)

>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet

Sequence, based on observed residues (ATOM records): (download)

>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkwgsssgsqgredsvlsyet

SCOP Domain Coordinates for d1kjwa1:

Click to download the PDB-style file with coordinates for d1kjwa1.
(The format of our PDB-style files is described here.)

Timeline for d1kjwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjwa2