Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Rhodospirillum centenum [TaxId:34018] [68947] (1 PDB entry) |
Domain d1jdla_: 1jdl A: [66557] complexed with hem |
PDB Entry: 1jdl (more details), 1.7 Å
SCOP Domain Sequences for d1jdla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdla_ a.3.1.1 (A:) Cytochrome c2 {Rhodospirillum centenum [TaxId: 34018]} gdpakgeavfkkcmachrvgpdaknlvgpaltgvidrqagtapgfnysainhaageaglh wtpeniiaylpdpnaflrkfladaghaeqakgstkmvfklpdeqerkdvvaylkqfsp
Timeline for d1jdla_: