Lineage for d1im8a_ (1im8 A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) 
Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (1 protein) Protein Hypothetical protein HI0319 (YecO) [69545] (1 species) Species Haemophilus influenzae [TaxId:727] [69546] (1 PDB entry)
structural genomics
Domain d1im8a_: 1im8 A: [66212]
CASP4
Details for d1im8a_
PDB Entry: 1im8 (more details), 2.2 Å
PDB Description: Crystal structure of YecO from Haemophilus influenzae (HI0319), a methyltransferase with a bound S-adenosylhomocysteine
PDB Compounds: (A:) YecOSCOP Domain Sequences for d1im8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}
fifdenvaevfpdmiqrsvpgysniitaigmlaerfvtadsnvydlgcsrgaatlsarrn
inqpnvkiigidnsqpmvercrqhiaayhseipveilcndirhveiknasmvilnftlqf
lppedrialltkiyeglnpngvlvlsekfrfedtkinhllidlhhqfkrangyselevsq
krtalenvmrtdsiethkvrlknvgfsqvelwfqcfnfgsmiavk
SCOP Domain Coordinates for d1im8a_:
Click to download the PDB-style file with coordinates for d1im8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1im8a_:
- d1im8a_ first appeared in SCOP 1.59
- d1im8a_ appears in SCOP 1.73
- d1im8a_ appears in SCOPe 2.01
- d1im8a_ appears in the current release, SCOPe 2.08
View in 3D
