Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) |
Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (1 protein) |
Protein Hypothetical protein HI0319 (YecO) [69545] (1 species) |
Species Haemophilus influenzae [TaxId:727] [69546] (1 PDB entry) structural genomics |
Domain d1im8a_: 1im8 A: [66212] CASP4 |
PDB Entry: 1im8 (more details), 2.2 Å
SCOP Domain Sequences for d1im8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} fifdenvaevfpdmiqrsvpgysniitaigmlaerfvtadsnvydlgcsrgaatlsarrn inqpnvkiigidnsqpmvercrqhiaayhseipveilcndirhveiknasmvilnftlqf lppedrialltkiyeglnpngvlvlsekfrfedtkinhllidlhhqfkrangyselevsq krtalenvmrtdsiethkvrlknvgfsqvelwfqcfnfgsmiavk
Timeline for d1im8a_: