Lineage for d1qhqa_ (1qhq A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791147Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 791197Protein Auracyanin [63686] (1 species)
    azurin-related protein
  7. 791198Species Chloroflexus aurantiacus [TaxId:1108] [63687] (2 PDB entries)
  8. 791199Domain d1qhqa_: 1qhq A: [63326]
    complexed with cl, cu, so4

Details for d1qhqa_

PDB Entry: 1qhq (more details), 1.55 Å

PDB Description: auracyanin, a blue copper protein from the green thermophilic photosynthetic bacterium chloroflexus aurantiacus
PDB Compounds: (A:) protein (auracyanin)

SCOP Domain Sequences for d1qhqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]}
anapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwvl
vnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtylyi
ctfpghylagmkgtltvtp

SCOP Domain Coordinates for d1qhqa_:

Click to download the PDB-style file with coordinates for d1qhqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qhqa_: