Lineage for d1ihja_ (1ihj A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 797888Protein Inad [63756] (1 species)
  7. 797889Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63757] (1 PDB entry)
  8. 797890Domain d1ihja_: 1ihj A: [62382]
    first PDZ domain; complexed with a Norpa C-terminal peptide

Details for d1ihja_

PDB Entry: 1ihj (more details), 1.8 Å

PDB Description: Crystal Structure of the N-terminal PDZ domain of InaD in complex with a NorpA C-terminal peptide
PDB Compounds: (A:) InaD

SCOP Domain Sequences for d1ihja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gelihmvtldktgkksfgicivrgevkdspntkttgifikgivpdspahlcgrlkvgdri
lslngkdvrnsteqavidlikeadfkieleiqtf

SCOP Domain Coordinates for d1ihja_:

Click to download the PDB-style file with coordinates for d1ihja_.
(The format of our PDB-style files is described here.)

Timeline for d1ihja_:

797890
d1ihja_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ihjb_