Lineage for d5hpga_ (5hpg A:)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily)
disulfide-rich fold; nearly all-betaSuperfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (6 proteins) 
Protein Plasminogen [63400] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63401] (18 PDB entries) 
Domain d5hpga_: 5hpg A: [44642]
kringle 5
Details for d5hpga_
PDB Entry: 5hpg (more details), 1.66 Å
PDB Description: structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
PDB Compounds: (A:) plasminogenSCOP Domain Sequences for d5hpga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hpga_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
gpwcyttnprklydycdvpqcaap
SCOP Domain Coordinates for d5hpga_:
Click to download the PDB-style file with coordinates for d5hpga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hpga_:
- d5hpga_ first appeared (with stable ids) in SCOP 1.55
- d5hpga_ appears in SCOP 1.73
- d5hpga_ appears in SCOPe 2.01
- d5hpga_ appears in the current release, SCOPe 2.08
View in 3D
