Lineage for d1aq6a_ (1aq6 A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (25 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.1: HAD-related [56785] (2 proteins)
the insertion subdomain is a 4-helical bundleProtein L-2-Haloacid dehalogenase, HAD [56786] (2 species) Species Xanthobacter autotrophicus [TaxId:280] [56788] (4 PDB entries) 
Domain d1aq6a_: 1aq6 A: [43331]
Details for d1aq6a_
PDB Entry: 1aq6 (more details), 1.95 Å
PDB Description: structure of l-2-haloacid dehalogenase from xanthobacter autotrophicus
PDB Compounds: (A:) l-2-haloacid dehalogenaseSCOP Domain Sequences for d1aq6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq6a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}
mikavvfdaygtlfdvqsvadateraypgrgeyitqvwrqkqleyswlralmgryadfwg
vtrealaytlgtlglepdesfladmaqaynrltpypdaaqclaelaplkrailsngapdm
lqalvanagltdsfdavisvdakrvfkphpdsyalveevlgvtpaevlfvssngfdvgga
knfgfsvarvarlsqealarelvsgtiapltmfkalrmreetyaeapdfvvpalgdlprl
vrgma
SCOP Domain Coordinates for d1aq6a_:
Click to download the PDB-style file with coordinates for d1aq6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aq6a_:
- d1aq6a_ first appeared (with stable ids) in SCOP 1.55
- d1aq6a_ appears in SCOP 1.73
- d1aq6a_ appears in SCOPe 2.01
- d1aq6a_ appears in the current release, SCOPe 2.08
View in 3D
