Lineage for d1qnaa2 (1qna A:116-198)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872516Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 872517Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 872518Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 872577Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries)
  8. 872579Domain d1qnaa2: 1qna A:116-198 [41227]

Details for d1qnaa2

PDB Entry: 1qna (more details), 1.8 Å

PDB Description: crystal structure of the t(-30) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
PDB Compounds: (A:) protein (transcription initiation factor tfiid-1)

SCOP Domain Sequences for d1qnaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnaa2 d.129.1.1 (A:116-198) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrki

SCOP Domain Coordinates for d1qnaa2:

Click to download the PDB-style file with coordinates for d1qnaa2.
(The format of our PDB-style files is described here.)

Timeline for d1qnaa2:

872579
d1qnaa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qnaa1