Lineage for d1cc8a_ (1cc8 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863121Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family) (S)
  5. 863122Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins)
  6. 863123Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 863124Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (5 PDB entries)
  8. 863125Domain d1cc8a_: 1cc8 A: [39343]

Details for d1cc8a_

PDB Entry: 1cc8 (more details), 1.02 Å

PDB Description: crystal structure of the atx1 metallochaperone protein
PDB Compounds: (A:) protein (metallochaperone atx1)

SCOP Domain Sequences for d1cc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
ktgkevrsgkql

SCOP Domain Coordinates for d1cc8a_:

Click to download the PDB-style file with coordinates for d1cc8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cc8a_: