Lineage for d1fm0d_ (1fm0 D:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854164Superfamily d.15.3: MoaD/ThiS [54285] (4 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 854165Family d.15.3.1: MoaD [54286] (2 proteins)
  6. 854172Protein Molybdopterin synthase subunit MoaD [54287] (2 species)
  7. 854173Species Escherichia coli [TaxId:562] [54288] (7 PDB entries)
  8. 854174Domain d1fm0d_: 1fm0 D: [37642]
    Other proteins in same PDB: d1fm0e_
    complexed with MoaE
    complexed with cl

Details for d1fm0d_

PDB Entry: 1fm0 (more details), 1.45 Å

PDB Description: molybdopterin synthase (moad/moae)
PDB Compounds: (D:) molybdopterin convertin factor, subunit 1

SCOP Domain Sequences for d1fm0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg

SCOP Domain Coordinates for d1fm0d_:

Click to download the PDB-style file with coordinates for d1fm0d_.
(The format of our PDB-style files is described here.)

Timeline for d1fm0d_: