Lineage for d1glcg1 (1glc G:4-253)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) 
duplication contains two domains of this fold
Family c.55.1.4: Glycerol kinase [53089] (1 protein) Protein Glycerol kinase [53090] (2 species) Species Escherichia coli [TaxId:562] [53091] (13 PDB entries) 
Domain d1glcg1: 1glc G:4-253 [33519]
Other proteins in same PDB: d1glcf_
Details for d1glcg1
PDB Entry: 1glc (more details), 2.65 Å
PDB Description: cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation
PDB Compounds: (G:) glycerol kinaseSCOP Domain Sequences for d1glcg1:
Sequence, based on SEQRES records: (download)
>d1glcg1 c.55.1.4 (G:4-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlvev
lakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgledy
irsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtdy
tnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgia
gdqqaalfgq
Sequence, based on observed residues (ATOM records): (download)
>d1glcg1 c.55.1.4 (G:4-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlvev
lakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgledy
irsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtdy
tnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniipisgiagdqqaal
fgq
SCOP Domain Coordinates for d1glcg1:
Click to download the PDB-style file with coordinates for d1glcg1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1glcg1:
- d1glcg1 first appeared (with stable ids) in SCOP 1.55
- d1glcg1 appears in SCOP 1.73
- d1glcg1 appears in SCOPe 2.01
- d1glcg1 appears in the current release, SCOPe 2.08
View in 3D
