Lineage for d1bu6o2 (1bu6 O:254-499)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 836354Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 836355Protein Glycerol kinase [53090] (2 species)
  7. 836365Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 836387Domain d1bu6o2: 1bu6 O:254-499 [33500]

Details for d1bu6o2

PDB Entry: 1bu6 (more details), 2.37 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation
PDB Compounds: (O:) protein (glycerol kinase)

SCOP Domain Sequences for d1bu6o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu6o2 c.55.1.4 (O:254-499) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOP Domain Coordinates for d1bu6o2:

Click to download the PDB-style file with coordinates for d1bu6o2.
(The format of our PDB-style files is described here.)

Timeline for d1bu6o2: