Lineage for d1b96a_ (1b96 A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the restSuperfamily c.52.1: Restriction endonuclease-like [52980] (33 families) 
Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein) Protein Restriction endonuclease EcoRV [52985] (1 species) Species Escherichia coli [TaxId:562] [52986] (29 PDB entries) 
Domain d1b96a_: 1b96 A: [33268]
Details for d1b96a_
PDB Entry: 1b96 (more details), 2.3 Å
PDB Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group
PDB Compounds: (A:) restriction endonuclease ecorvSCOP Domain Sequences for d1b96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b96a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqenhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk
SCOP Domain Coordinates for d1b96a_:
Click to download the PDB-style file with coordinates for d1b96a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b96a_:
- d1b96a_ first appeared (with stable ids) in SCOP 1.55
- d1b96a_ appears in SCOP 1.73
- d1b96a_ appears in SCOPe 2.01
- d1b96a_ appears in the current release, SCOPe 2.08
View in 3D
