Lineage for d1rhsa1 (1rhs A:1-149)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) 
Pfam PF00581
the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
duplication: consists of two domains of this foldProtein Rhodanese [52828] (1 species) Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) 
Domain d1rhsa1: 1rhs A:1-149 [32703]
Details for d1rhsa1
PDB Entry: 1rhs (more details), 1.36 Å
PDB Description: sulfur-substituted rhodanese
PDB Compounds: (A:) sulfur-substituted rhodaneseSCOP Domain Sequences for d1rhsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]}
vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
rtvsvlnggfrnwlkeghpvtsepsrpep
SCOP Domain Coordinates for d1rhsa1:
Click to download the PDB-style file with coordinates for d1rhsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rhsa1:
- d1rhsa1 first appeared (with stable ids) in SCOP 1.55, called d1rhs_1
- d1rhsa1 appears in SCOP 1.73
- d1rhsa1 appears in SCOPe 2.01
- d1rhsa1 appears in the current release, SCOPe 2.08
View in 3D
