Lineage for d1g6oa_ (1g6o A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (17 proteins)
core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
Protein Hexameric traffic ATPase, HP0525 [52719] (1 species)
type II/IV secretion system protein; includes N-terminal alpha+beta domain of a profilin-like topologySpecies Helicobacter pylori [TaxId:210] [52720] (5 PDB entries) 
Domain d1g6oa_: 1g6o A: [32430]
structural genomics
Details for d1g6oa_
PDB Entry: 1g6o (more details), 2.5 Å
PDB Description: crystal structure of the helicobacter pylori atpase, hp0525, in complex with adp
PDB Compounds: (A:) cag-alphaSCOP Domain Sequences for d1g6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}
lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
fkdlidmivhinhhkqcdefyik
SCOP Domain Coordinates for d1g6oa_:
Click to download the PDB-style file with coordinates for d1g6oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g6oa_:
- d1g6oa_ first appeared (with stable ids) in SCOP 1.55
- d1g6oa_ appears in SCOP 1.73
- d1g6oa_ appears in SCOPe 2.01
- d1g6oa_ appears in the current release, SCOPe 2.08
View in 3D
