Lineage for d1bg6a2 (1bg6 A:4-187)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) 
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
C-terminal domains also show some similarity
Protein N-(1-D-carboxylethyl)-L-norvaline dehydrogenase [51879] (1 species) Species Arthrobacter, strain 1c [TaxId:1663] [51880] (1 PDB entry) 
Domain d1bg6a2: 1bg6 A:4-187 [30214]
Other proteins in same PDB: d1bg6a1
Details for d1bg6a2
PDB Entry: 1bg6 (more details), 1.8 Å
PDB Description: crystal structure of the n-(1-d-carboxylethyl)-l-norvaline dehydrogenase from arthrobacter sp. strain 1c
PDB Compounds: (A:) n-(1-d-carboxylethyl)-l-norvaline dehydrogenaseSCOP Domain Sequences for d1bg6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}
sktyavlglgngghafaaylalkgqsvlawdidaqrikeiqdrgaiiaegpglagtahpd
lltsdiglavkdadvilivvpaihhasiaaniasyisegqliilnpgatggalefrkilr
engapevtigetssmlftcrserpgqvtvnaikgamdfaclpaakagwaleqigsvlpqy
vave
SCOP Domain Coordinates for d1bg6a2:
Click to download the PDB-style file with coordinates for d1bg6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bg6a2:
- d1bg6a2 first appeared (with stable ids) in SCOP 1.55, called d1bg6_2
- d1bg6a2 appears in SCOP 1.73
- d1bg6a2 appears in SCOPe 2.01
- d1bg6a2 appears in the current release, SCOPe 2.08
View in 3D
