Lineage for d2arca_ (2arc A:)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.4: Regulatory protein AraC [51215] (1 family) 
Family b.82.4.1: Regulatory protein AraC [51216] (1 protein) Protein Regulatory protein AraC [51217] (1 species)
contains an alpha-hairpin in the C-terminal extensionSpecies Escherichia coli [TaxId:562] [51218] (4 PDB entries)
Uniprot P03021
Domain d2arca_: 2arc A: [28148]
Details for d2arca_
PDB Entry: 2arc (more details), 1.5 Å
PDB Description: escherichia coli regulatory protein arac complexed with l-arabinose
PDB Compounds: (A:) arabinose operon regulatory proteinSCOP Domain Sequences for d2arca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}
dpllpgysfnahlvagltpieangyldffidrplgmkgyilnltirgqgvvknqgrefvc
rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
qphfsdlfgqiinagqgegrysellainlleqlllrrmeai
SCOP Domain Coordinates for d2arca_:
Click to download the PDB-style file with coordinates for d2arca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2arca_:
- d2arca_ first appeared (with stable ids) in SCOP 1.55
- d2arca_ appears in SCOP 1.73
- d2arca_ appears in SCOPe 2.01
- d2arca_ appears in the current release, SCOPe 2.08
View in 3D
