Lineage for d1bplb1 (1bpl B:394-482)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808243Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 808252Species Bacillus licheniformis [TaxId:1402] [51014] (8 PDB entries)
  8. 808260Domain d1bplb1: 1bpl B:394-482 [27716]
    Other proteins in same PDB: d1bpl.1

Details for d1bplb1

PDB Entry: 1bpl (more details), 2.2 Å

PDB Description: glycosyltransferase
PDB Compounds: (B:) alpha-1,4-glucan-4-glucanohydrolase

SCOP Domain Sequences for d1bplb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bplb1 b.71.1.1 (B:394-482) Bacterial alpha-Amylase {Bacillus licheniformis [TaxId: 1402]}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvq

SCOP Domain Coordinates for d1bplb1:

Click to download the PDB-style file with coordinates for d1bplb1.
(The format of our PDB-style files is described here.)

Timeline for d1bplb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bpl.1
View in 3D
Domains from other chains:
(mouse over for more information)
d1bpl.1