Lineage for d1kwaa_ (1kwa A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 797816Protein Cask/Lin-2 [50160] (1 species)
  7. 797817Species Human (Homo sapiens) [TaxId:9606] [50161] (1 PDB entry)
  8. 797818Domain d1kwaa_: 1kwa A: [24772]

Details for d1kwaa_

PDB Entry: 1kwa (more details), 1.93 Å

PDB Description: human cask/lin-2 pdz domain
PDB Compounds: (A:) hcask/lin-2 protein

SCOP Domain Sequences for d1kwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]}
rsrlvqfqkntdepmgitlkmnelnhcivarimhggmihrqgtlhvgdeireingisvan
qtveqlqkmlremrgsitfkivpsyref

SCOP Domain Coordinates for d1kwaa_:

Click to download the PDB-style file with coordinates for d1kwaa_.
(The format of our PDB-style files is described here.)

Timeline for d1kwaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kwab_