Lineage for d2ctha_ (2cth A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
variable number of helices and little beta structure; not a true foldSuperfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
duplication: contains multiple CxxCH motifsFamily a.138.1.1: Cytochrome c3-like [48696] (4 proteins) Protein Cytochrome c3 [48697] (7 species)
contains four heme groupsSpecies Desulfovibrio vulgaris [TaxId:881] [48699] (11 PDB entries)
Uniprot P00132
Domain d2ctha_: 2cth A: [19652]
Details for d2ctha_
PDB Entry: 2cth (more details), 1.67 Å
PDB Description: cytochrome c3 from desulfovibrio vulgaris hildenborough
PDB Compounds: (A:) cytochrome c3SCOP Domain Sequences for d2ctha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctha_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche
SCOP Domain Coordinates for d2ctha_:
Click to download the PDB-style file with coordinates for d2ctha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ctha_:
- d2ctha_ first appeared (with stable ids) in SCOP 1.55
- d2ctha_ appears in SCOP 1.73
- d2ctha_ appears in SCOPe 2.01
- d2ctha_ appears in the current release, SCOPe 2.08
View in 3D
