Lineage for d1etxa_ (1etx A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (19 families) 
consists only of helices
Family a.4.1.12: FIS-like [100918] (4 proteins) Protein FIS protein [48285] (1 species)
includes N-terminal dimerisation subdomainSpecies Escherichia coli [TaxId:562] [48286] (12 PDB entries) 
Domain d1etxa_: 1etx A: [18978]
Details for d1etxa_
PDB Entry: 1etx (more details), 1.9 Å
PDB Description: the crystal structure of e. coli fis mutant q74a
PDB Compounds: (A:) factor for inversion stimulationSCOP Domain Sequences for d1etxa_:
Sequence, based on SEQRES records: (download)
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
vltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqy
trgnatraalmmginrgtlrkklkkygmn
Sequence, based on observed residues (ATOM records): (download)
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
vltvkplrdsvkqalknyfaqlvndlyelvlaeveqplldmvmqytrgnatraalmmgin
rgtlrkklkkygmn
SCOP Domain Coordinates for d1etxa_:
Click to download the PDB-style file with coordinates for d1etxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1etxa_:
- d1etxa_ first appeared (with stable ids) in SCOP 1.55
- d1etxa_ appears in SCOP 1.73
- d1etxa_ appears in SCOPe 2.01
- d1etxa_ appears in the current release, SCOPe 2.08
View in 3D
