Lineage for d1alva_ (1alv A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (11 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins) 
Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) Species Pig (Sus scrofa) [TaxId:9823] [47555] (6 PDB entries) 
Domain d1alva_: 1alv A: [17370]
Details for d1alva_
PDB Entry: 1alv (more details), 1.9 Å
PDB Description: calcium bound domain vi of porcine calpain
PDB Compounds: (A:) calpainSCOP Domain Sequences for d1alva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys
SCOP Domain Coordinates for d1alva_:
Click to download the PDB-style file with coordinates for d1alva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1alva_:
- d1alva_ first appeared (with stable ids) in SCOP 1.55
- d1alva_ appears in SCOP 1.73
- d1alva_ appears in SCOPe 2.01
- d1alva_ appears in the current release, SCOPe 2.08
View in 3D
